5E4: ZU-V000-003-265 Выключатель S230B 12(12)A 250V ~ 5E4, Применение

Содержание

Двигатель Cummins серии ISB4.5e4 185 — фото, характеристики, схема, описание

Показатели работы двигателя на режимах
Максимальная мощность Максимальный момент
Частота вращения 2500 об/мин 1400 об/мин
Мощность (нетто) 177 л.с. 140 л.с.
Крутящий момент 504Нм 700 Нм
Давление на выходе из турбокомпрессора 158 кПа 117 кПа
Поток воздуха на впуске 10.5 м3/мин 5.34 м3/мин
Поток наддувочного воздуха 12 кг/мин 6 кг/мин
Поток отработавших газов 22.02 м3/мин 14.04 м3/мин
Температура отработавших газов 464 °С 559 °С
Расход топлива 29 кг/ч 21 кг/ч
Отвод тепла в ОЖ 71 кВт 55 кВт
Отвод тепла в атмосферу 24 кВт 11 кВт
Мощность, затрачиваемая на трение 23 кВт 12 кВт
Крутящий момент*
Обороты/мин. Нм
1000 550
1100 625
1200 700
1300 700
1400 700
1500 700
1600 700
1700 678
1800
657
1900 635
2000 613
2100 591
2300 548
2500 504
Мощность*
Обороты/мин. л.с. кВт
1000 79 58
1100 98 72
1200 120 88
1300 129 95
1400 140 103
1500 150 110
1600 159 117
1700 165 121
1800 169 124
1900 171 126
2000 174 128
2100 177 130
2300 177 130
2500 177 130
Система впуска воздуха
Максимальное повышение температуры воздуха на впуске в компрессор ТКР (для двигателей с турбонаддувом) или во впускной коллектор (для двигателей без наддува) в сравнении с температурой окружающего воздуха: Δ15 ºС
Максимально допустимое разряжение перед входом в ТКР С «чистым» фильтрующим элементом 3.7 кПа
С «загрязненным» фильтрующим элементом 5.0 кПа
Система охлаждения
Максимальная температура во впускном коллекторе при температуре Окружающего воздуха 25°С: 55°С
Максимально допустимый перепад давления в воздушном патрубке от компрессора к ОНВ: 13.5 кПа
Максимальное повышение температуры воздуха во впускном коллекторе в сравнении с температурой окружающего воздуха: Δ30 ºС
Рекомендуемый внутренний диаметр патрубков (не менее): 65 мм
Максимальная температура ОЖ, при которой срабатывает система защиты двигателя: 113 ºС
Максимальная рабочая температура ОЖ на выходе из двигателя: 107 ºС
Система выпуска
Максимальное противодавление системы выпуска:
20 кПа
Рекомендуемый внутренний диаметр выпускной трубы (не менее): 100 мм
Максимальный момент изгиба фланца турбины ТКР 15 Н*м
Пуск двигателя в холодный период:
Минимальная температура запуска без использования средств облегчения запуска: -10 ºС @ 120 об/мин
Минимальная температура запуска с использованием подогревателя воздуха во впускном трубопроводе: -22 ºС @ 120 об/мин
Минимальная температура запуска с использованием подогревателя ОЖ и масла: -45°С @ 100 об/мин
Рабочие характеристики:
Максимальные обороты холостого хода: 2850 об/мин
Минимальные обороты холостого хода: 600 — 800 об/мин
Максимальная высота эксплуатации: 3000 м
Максимальный крутящий момент, передаваемый через передний фланец коленчатого вала: 410 Н*м
Максимальное давление на выходе из турбины ТКР при использовании моторного тормоза при частоте вращения коленчатого вала 2850 об/мин 430 кПа

Военное звание микровыключатель 5e4 t85 по лучшим предложениям Certified Products

О продукте и поставщиках:
микровыключатель 5e4 t85 на Alibaba.com предлагает совершенно новый мир полезности по разумным ценам. микровыключатель 5e4 t85 определяет комфорт в домашних электронных устройствах, потому что они используют очень мало давления, чтобы активировать переключатель. Это связано с использованием механизма переломного момента, который придает изюминку использованию. микровыключатель 5e4 t85 недорогие, но долговечные благодаря механизму строительства.  

микровыключатель 5e4 t85 обеспечивают высокий уровень долговечности, часто от 1 миллиона до 10 миллионов циклов, поэтому вы можете использовать этот продукт в течение многих лет без необходимости их замены. Несколько. микровыключатель 5e4 t85 функция гистерезиса - что означает дополнительную функциональность и удобство использования этого привлекательного продукта. микровыключатель 5e4 t85 используются в нескольких областях для управления электрическими цепями. К ним относятся автомобили, промышленные средства управления, оборудование и приборы.

микровыключатель 5e4 t85 дизайны на Alibaba.com предлагаются в эстетичных цветах и формах, чтобы добавить красоту и практичность. Благодаря компактной конструкции эти изделия используются в оборудовании автоматизации. Высокое качество. Предлагаемые здесь микровыключатель 5e4 t85 можно узнать по их конечному использованию. Некоторые из них потрясающие. микровыключатель 5e4 t85 используются в аэрокосмической отрасли, на кораблях, ракетах, танках и в других областях, требующих высокоточных компонентов.

Выберите ваши личные требования. микровыключатель 5e4 t85 из множества товаров, предлагаемых на Alibaba.com. Изучите обзоры, спецификации продуктов и поговорите с продавцами в Интернете. микровыключатель 5e4 t85 поставщики и оптовики могут найти новые перспективы для бизнеса, установив связи с международными продавцами, предлагающими букет продуктов по отличным ценам.

Плавный пуск,подходит для всех видов УШМ, электрокос ,электропил 15А 250V-5E4

Бренд:
Кит. 1
450 руб

Нет в наличии

Плавный пуск,подходит для всех видов УШМ, электрокос ,электропил 15А 250V-5E4


Перевод 5E4 из шестнадцатеричной в восьмеричную систему счисления

Задача: перевести число 5E4 из шестнадцатеричной в восьмеричную систему счисления.

Для перевода 5E4 из шестнадцатеричной в восьмеричную систему счисления, воспользуемся следующим алгоритмом:

  1. Переведем число 5E4 из шестнадцатеричной системы в десятичную;
  2. Полученное число переведём из десятичной системы в восьмеричную;

Решение:

1. Для перевода числа 5E4 в десятичную систему воспользуемся формулой:

An = an-1 ∙ qn-1 + an-2 ∙ qn-2 + ∙∙∙ + a0 ∙ q0

Отсюда:

5E416=5 ∙ 162 + E ∙ 161 + 4 ∙ 160 = 5 ∙ 256 + 14 ∙ 16 + 4 ∙ 1 = 1280 + 224 + 4 = 150810

Таким образом:

5E416 = 150810

2. Полученное число 1508 переведем из десятичной системы счисления в восьмеричную. Для этого, осуществим последовательное деление на 8, до тех пор пока остаток не будет меньше чем 8.

1508 8
1504 188 8
4 184 23 8
4 16 2
7

Полученные остатки записываем в обратном порядке, таким образом:

150810=27448

Ответ: 5E416 = 27448.

Смотрите также:

  • Смотрите также
  • Калькуляторы
  • Последние переводы

Полезные материалы

Калькуляторы переводов

Последние примеры переводов из 16-ой в 8-ую систему

Оцените материал:

Загрузка…

Поделиться с друзьями:

Выключатель света для холодильника Beko 5E4 25T85 4094880285, цена 60 грн

Выключатель света для холодильника Beko 5E4 25T85 4094880285

Кодировка данного товара: 4094880285

Аналоги: 4212400285
Количество контактов: 2

Подходит к моделям (представлены не все модели):

 

Для быстрого поиска своей модели воспользуйтесь сочетанием клавиш Ctrl + F

 

Beko

14630NELX, 6500S, 7121Y, 7125, 9560NBEX, ACN170DE, ALD250, AP930S, AP930X, ASML142B, B1020, B1750HCA, B1751, B1752, B1800HCBW,  B1802, B1810HCA,  B3000HCA, B773HCA, B8181SM, B8450SM, B8550SM, B9330NMN, B9459NMN, B9463NMS, B9477NE,  B9540NM, BAC517, BAC553,BC502, BC50FC,BC732, BCC7030F, BFC416,БК-8460Т,BK7270T, BK8340T, BK9551NF, BL21, BU1153, CA5411FFS, CA5411FFX, CA6017S, CA7014FFW,  CA7014FFX, CA7015FFS-1, CBI7700HCA, CBI7702LH, CBI7703, CBI7705, CBI7750HCA, CBI7770HCA +,  CCh5860, CR4860, CDA538W, CDA539FW, CDA541S, CDA554S, CDA555FW,  CDA563FS, CDA644S, CDA645FW, CDA647FS, CDA648FS,   CDA650W, CDA653FS-1, CDA751FX, CDP7601A+, CF5015APS, CF540B, CF6004APX, CF6713S1, CF6914S, CF6914W, CFD640B, CFD6643S, CFD6643W , CFD6913S , CFD7914APS,  CFF6873GR, CFG1552S , CFL7914S , CFP1691B, Ch236010S, Ch240020DS, CHA34020,CHA36000,
 CHE30000S, CHE33200, CHE34001D,  CHE44000DE, CIE28000, CMB340B,CN136221, CN136230P,CN136232X , CN140221DX,CN148232X,
 CN151920D, CN228221, CNE30220GR, CNE32100DS,  CNL332204W, COOL54FW, COOL64FDB, CS234022B, CS234022S, CS234030, CS234031T,  CSA34001S, CSA34002, CSA34010,CSA34020, CSA34022, CSA34022S,  CSA38220D, CSA38220X,CSA38221D, CSA4706FF, CSA4706FFX,  CSA576S, CSE24007,  CSE24020, CSE24027, CSE31000, CSE34020, CSE37080, CSK30000, CSK310M20W, CSK321CA, CVA34103, D8340SM, D8459SM, DBKE386X +,  DN162720D, DNE57630W, DNE65500M,
 DNE68720WG,DNE68721DT, DS133010S, DS133012 , DS141120X, DS145000S, DS145100, DS148102, DS149010S, DS149012,
 DS230000S,  DS333020S, DSE140S, DSE20021, DSE25002, FF6091X, FFD5582W, GL12APS, GNE45706X, GNE46102PX,
GNE60570X, GNEV021W, GNEV222S, GNEV320APS, GNEV422X, LE145, NDU9950, RBI2301,RDE6193KL, SS133421, SS137020D,SS137020DS,  SS137020X, SS137021D, SS137030, SS137030PX,  SS140020, SSA27010, SSE32000, SSE32003, SSE32004, SSE37021DS, SSE37024D, TL654W, TLA602B, TLDA520S, TLDA521W-2, TLF550W-2, TS190320, TSE1240,TSE1241, TSE1281M, TSE1351S
, TSE1352, TSE1404,TSE1552T, UL483APW, UR584APS

 

 

Важно! Уважаемые клиенты, во избежание ошибок при выборе товара в интернет — магазине обращайтесь за помощью к нашему менеджеру для получения более детальной информации.

 

Глюкокортикоидный рецептор мыши против человека, FITC, Клон: 5E4, Invitrogen

Описание

Для проточной цитометрии требуется мембранная проницаемость. Для анализа FACS используйте 10 мкл предложенного рабочего разведения, чтобы пометить 1 × 10 6 клеток в 100 мкл. Мышиное антитело против рецептора глюкокортикоидов человека, клон 5E4 распознает рецептор глюкокортикоидов человека, также известный как член 1 группы C подсемейства 3 ядерных рецепторов (NR3C1), рецептор из 777 аминокислот, несущий 3 различных функциональных домена, N-концевой модулирующий домен, ДНК связывающий домен и С-концевой стероидный связывающий домен.

Белок, кодируемый этим геном, является рецептором глюкокортикоидов, который может действовать как фактор транскрипции и как регулятор других факторов транскрипции. Этот белок также может быть обнаружен в гетеромерных цитоплазматических комплексах вместе с факторами теплового шока и иммунофилинами. Белок обычно находится в цитоплазме до тех пор, пока не связывает лиганд, который индуцирует транспорт в ядро.Мутации в этом гене являются причиной устойчивости к глюкокортикоидам или кортизолу. Альтернативный сплайсинг, использование по крайней мере трех разных промоторов и альтернативных сайтов инициации трансляции приводит к нескольким вариантам транскрипта, кодирующим один и тот же белок или разные изоформы, но полноразмерная природа некоторых вариантов не была определена.

Антитело к бета-тубулину (моноклональное, 5E4)

Название продукта

Анти-бета-тубулин-антитело Picoband ™ (моноклональное, 5E4)

Посмотреть все продукты с бета-тубулином

Артикул / Каталожный номер

M01857-3

Размер

100 мкг / флакон

Форма

Лиофилизированный

Описание

Boster Bio Anti-Beta Tubulin Antibody Picoband ™ (моноклональное, 5E4), каталог № M01857-3.Протестировано в приложениях проточной цитометрии, IF, ICC, WB. Это антитело реагирует с человеком, мышью, крысой.

Хранение и обращение

Хранить при -20 ° C в течение одного года с даты получения. После восстановления при 4˚C в течение одного месяца. Его также можно разделить на аликвоты и хранить замороженным при -20 ° C в течение шести месяцев. Избегайте повторяющихся циклов замораживания-оттаивания.

Цитируйте этот продукт

Анти-бета-тубулин-антитело Picoband ™ (моноклональное, 5E4) (Boster Biological Technology, Плезантон, Калифорния, США, Каталожный № M01857-3)

Хост

Мышь

Содержание

Каждый флакон содержит 4 мг трегалозы, 0.9 мг NaCl, 0,2 мг Na 2 HPO 4 , 0,05 мг NaN 3 .

Клональность

Моноклональный

Номер клона

5E4

Изотип

IgG1

Иммуноген

Синтетический пептид, соответствующий последовательности на С-конце бета-тубулина человека (383-412aa EQFTAMFRRKAFLHWYTGEGMDEMEFTEAE), идентичный родственным последовательностям мыши и крысы.

* Блокирующий пептид можно купить. Стоимость варьируется в зависимости от длины иммуногена.Свяжитесь с нами, чтобы узнать цену.

Перекрестная реактивность

Нет перекрестной реактивности с другими белками.

Реактивные частицы

M01857-3 реагирует на TUBB у человека, мыши, крысы

Приложения

M01857-3 имеет гарантию для проточной цитометрии, IF, ICC, WB Гарантия Boster

Проверка антител

Boster проверяет все антитела с помощью WB, IHC, ICC, иммунофлуоресценции и ELISA с известными положительными и отрицательными образцами для обеспечения специфичности и высокой аффинности.

Подробнее

Награда ученых-новаторов

Если вы первым просматриваете этот продукт, или если у вас есть результаты для особого образца, вида или приложения, в котором этот продукт не прошел валидацию, поделитесь своими результатами с нами и получите следующий набор антител / ELISA бесплатно! Применимо ко всем ученым во всем мире.

Отправить обзор

omron% 205e4% 20t85 техническое описание и примечания к применению

омрон

Аннотация: E32-TC200E E32-TC500 E3X-nm E32-T11 E39-F3A E32-D11 E32-DC200 E32-C42 TC200
Текст: нет текста в файле


Оригинал
PDF E32-TC50 / 200/500/1000, E32-T11 E32-TC200C, E32-T61) E39-F1 E39-F2 E39-F1 E39-F3 1-800-55-ОМРОН омрон E32-TC200E E32-TC500 E3X-нм E39-F3A E32-D11 E32-DC200 E32-C42 TC200
2000 — перекрестная ссылка реле

Аннотация: оптопара OMRON Реле Aromat 5-контактное реле NO NC Светодиод перекрестная ссылка OMRON RELAY Перекрестная ссылка OMRON 250v relay ac 11 pin CP Clare RELAY AQW216S Aromat relay
Текст: нет текста в файле


Оригинал
PDF 1/00/1 млн перекрестная ссылка реле omron оптопара Ароматное реле 5-контактное реле NO NC светодиодная перекрестная ссылка Перекрестная ссылка OMRON RELAY OMRON 250v реле ac 11 pin CP Clare РЕЛЕ AQW216S Реле ароматических масел
мейсей

Аннотация: M4-24H m4-12h OMRON G5L meisei m4 M3-12H M3-24H m4 12h finder 40.61 Schrack RT424012
Текст: нет текста в файле


Сканирование OCR
PDF pa30MKHyTbie А / 250 В переменного тока RT424012 RM94-P-24V RM94-1012-25-1024 RT424024 RM96-P-12V RM96-1011-25-1012 Meisei M4-24H m4-12h OMRON G5L Meisei M4 M3-12H M3-24H м4 12ч искатель 40.61 Schrack rt424012
2010 — E6B2-CWZ6C

Аннотация: E6B2-CWZ5B E6B2-CWZ3E E6B2-CWZ1X SUS420J2
Текст: нет текста в файле


Оригинал
PDF Диаметр 40 мм.omron247 NL-2132 E6B2-CWZ6C E6B2-CWZ5B E6B2-CWZ3E E6B2-CWZ1X SUS420J2
NS8-TV00B-V2

Аннотация: NS10-TV00B-V2 NS8-TV01B-V2 NS12-TS01B-V2 NS5-SQ00B-V2 NS5-MQ00B-V2 NS10TV01BV2 NS5-SQ00 NS5 OMRON omron ns8-tv00b-v2
Текст: нет текста в файле


Оригинал
PDF X302-E3-01a NS8-TV00B-V2 NS10-TV00B-V2 NS8-TV01B-V2 NS12-TS01B-V2 NS5-SQ00B-V2 NS5-MQ00B-V2 NS10TV01BV2 NS5-SQ00 NS5 OMRON omron ns8-tv00b-v2
2014 — Y92E-S12PVC4A10M-L

Аннотация: абстрактный текст недоступен
Текст: нет текста в файле


Оригинал
PDF Y92E-S SUS316L Y92E-S12PVC4A2Mss D23I-E-01 Y92E-S12PVC4A10M-L
2010 — Нет в наличии

Аннотация: абстрактный текст недоступен
Текст: нет текста в файле


Оригинал
PDF omron247 NL-2132 J25I-E-01
2010 — OMRON H8Ps

Аннотация: абстрактный текст недоступен
Текст: нет текста в файле


Оригинал
PDF 256P / R omron247 NL-2132 OMRON H8Ps
фликкер-реле omron

Аннотация: абстрактный текст недоступен
Текст: нет текста в файле


Оригинал
PDF EN61812-1 IEC60664-1 h4RN-11 h4RN-21 omron247 L090-E1-02.мерцание РЕЛЕ omron
omron e8y

Аннотация: E8Y-A5B omron
Текст: нет текста в файле


Оригинал
PDF omron247 F833-E1-01 omron e8y E8Y-A5B омрон
2010 — омрон

Аннотация: абстрактный текст недоступен
Текст: нет текста в файле


Оригинал
PDF 1000P / R omron247 NL-2132 омрон
2006 — реле omron схема

Аннотация: абстрактный текст недоступен
Текст: нет текста в файле


Оригинал
PDF G3VM-0605024A G3VM-0605024A Рейтинг реле omron схема
2010 — омрон 61f-D21T-V1

Аннотация: абстрактный текст недоступен
Текст: нет текста в файле


Оригинал
PDF 61F-D21T-V1 61F-D21T-V1 omron247 NL-2132 omron 61f-D21T-V1
2005 — датчик приближения емкостной

Реферат: D018-E2-02A «Емкостной датчик приближения» E2K-F10MC1 E2K-F10MC2 ABS D-190 omron
Текст: нет текста в файле


Оригинал
PDF F502-EN2-04 E2K-F10MC2 E2K-F10MC1-A E2K-F10MC1 E2K-F10MC2-A omron247 D018-E2-02A емкостной датчик приближения D018-E2-02A «Емкостной датчик приближения» E2K-F10MC1 E2K-F10MC2 АБС Д-190 омрон
E32-TC200E

Аннотация: E32-T61 E32-TC50 E32-TC200 E32-TC500 E32-T11 E32-T51L E39-F3 E32-DC200E omron
Текст: нет текста в файле


Оригинал
PDF E32-TC50 / 200/500/1000, E32-T11 E32-TC200C, E32-T61) E39-F1 E39-F2 E39-F1 E39-F3 E32-D32) E39-F3A E32-TC200E E32-T61 E32-TC50 E32-TC200 E32-TC500 E32-T51L E39-F3 E32-DC200E омрон
2010 — 47-2П

Аннотация: Omron EE-SX677
Текст: нет текста в файле


Оригинал
PDF EE-SX47 / 67 100-мА EE-SX67 omron247 NL-2132 E382-E1-EESX4767 47-2П Omron EE-SX677
2009 — MY2k omron

Реферат: анализ отказов реле с МАГНИТНОЙ ГОЛОВКОЙ omron omron MY2K РЕЛЕ OMRON 12 В переменного тока omron MYK omron
Текст: нет текста в файле


Оригинал
PDF MY2K-02 omron247 J013-E1-02 MY2k omron omron МАГНИТНАЯ ГОЛОВКА анализ отказов реле omron MY2K РЕЛЕ OMRON 12 В переменного тока омрон MYK omron
CP1H-X40DT-D

Аннотация: CP1H-XA40DT1-D CJ1W-PRT21 CP1H-XA40DT-D CJ1W-TC101 CP1W-cn811 CJ1W-MAD42 CP1H-X40DT1-D CJ1W-PRM21 cp1h
Текст: нет текста в файле


Оригинал
PDF X302-E3-01rev CP1H-X40DT-D CP1H-XA40DT1-D CJ1W-PRT21 CP1H-XA40DT-D CJ1W-TC101 CP1W-cn811 CJ1W-MAD42 CP1H-X40DT1-D CJ1W-PRM21 cp1h
2011 — Нет в наличии

Аннотация: абстрактный текст недоступен
Текст: нет текста в файле


Оригинал
PDF E417-E1-01
4510 лист данных

Аннотация: Управление скоростью двигателя постоянного тока с помощью концевого выключателя OMRON 555 NBR 70 D4MC-5020 2 A 98 EN60947-1 Подключение распределительной панели переменного тока 6310 Технология Silicon Touch
Текст: нет текста в файле


Оригинал
PDF omron247 X019-E1-07.4510 лист данных Управление скоростью двигателя постоянного тока с помощью 555 NBR 70 концевой выключатель omron D4MC-5020 2 А 98 EN60947-1 подключение распределительной панели переменного тока 6310 Технология Silicon Touch
2011 — Нет в наличии

Аннотация: абстрактный текст недоступен
Текст: нет текста в файле


Оригинал
PDF NL-2132
2005 — «Датчик артериального давления»

Реферат: плата реле Omron Go электромедицинские ПРОЕКТЫ МАЛОЙ ЭЛЕКТРОНИКИ датчик группы крови omron
Текст: нет текста в файле


Оригинал
PDF Y031-E-01 «Датчик артериального давления» плата реле Omron Go электромедицинский ПРОЕКТЫ МАЛОЙ ЭЛЕКТРОНИКИ омрон датчик группы крови
E5CN-R2MT-500

Аннотация: E5CN-Q2MT-500 omron pt100 E5CN-Q2MT-500 Omron omron ct E54-CT1 PT100 omron OMRON E5CN-R2MT-500 E54-CT1 E5CN-RMT-500 E5CN-QMT-500
Текст: нет текста в файле


Оригинал
PDF Q085A 11-сегментный X302-E3-01 E5CN-R2MT-500 E5CN-Q2MT-500 omron pt100 E5CN-Q2MT-500 Omron omron CT E54-CT1 PT100 omron OMRON E5CN-R2MT-500 E54-CT1 E5CN-RMT-500 E5CN-QMT-500
2009 — upc 3842

Реферат: ZFX-SC150 240107 omron ZFX-SC90 Omron h4bf-8 Q26E-EN-01 цена камеры машинного зрения zfx-c ZFX-XC8A ZFX-SC50
Текст: нет текста в файле


Оригинал
PDF ZFX-C10 / 15-CD ZFX-C10-CD ZFX-C15-CD 194мм omron247 Q26E-EN-01 upc 3842 ZFX-SC150 240 107 омрон ZFX-SC90 Омрон h4bf-8 Q26E-EN-01 цена камеры машинного зрения zfx-c ZFX-XC8A ZFX-SC50
2014 — Нет в наличии

Аннотация: абстрактный текст недоступен
Текст: нет текста в файле


Оригинал
PDF UL508 J131-E1-02

5E4 Super — Yorke Electric Sound

ОПИСАНИЕ

5E4 был своего рода аномалией в истории Super amp.В каждой другой версии Super использовались две ламповые лампы 6L6 (или аналогичные 5881) с выходной мощностью примерно 30 Вт. Но в 5E4 использовалась силовая лампа 6V6 меньшей мощности с более низким напряжением на пластинах, чтобы получить усилитель с меньшей общей мощностью и запасом мощности. Он по-прежнему поставлялся в том же корпусе и по-прежнему имел пару 10-дюймовых динамиков Alnico, но в этой конфигурации он стал больше похож на усилитель среднего размера; ближе к усилителям Deluxe, Tremolux и Vibrolux в линейке Fender.

Это странно, потому что Fender всегда позиционировал Super как профессиональную модель с большой мощностью, запасом высоты и функциями для музыкантов, выступающих перед большой аудиторией.Так что я полагаю, неудивительно, что Fender отказался от этого варианта 6V6 после немногим более одного года производства; заменив его на 5F4 в 1956 году и вернув его в категорию больших мальчиков с двумя 6L6 и выходной мощностью около 30 Вт.

Но потеря истории — выигрыш современного игрока. 5E4 — почти идеальный твидовый усилитель для современных музыкантов. Он имеет ту же классическую схему, что и в 5E5 Pro, 5E7 Bandmaster и 5F4 Super, и объединяет эту схему с выходной секцией 6V6, работающей при ~ 390 вольт на пластинах.В результате получается великолепный твидовый оттенок с более управляемой мощностью 20 Вт. Более низкое напряжение означает меньший запас по мощности, и усилитель может быть доведен до восхитительных искажений при меньшей громкости, чем уши в ушах. Заметьте, он по-прежнему громкий, но это скорее усилитель среднего размера, который лучше подходит для небольших площадок, записи и домашних занятий.

Поскольку шасси 5E4 подходит для кабинетов Pro и Bandmaster, я также могу предложить этот усилитель в конфигурациях 1 × 12, 1 × 15 или даже 3 × 10.

Вот отличное описание и фоновая часть 5E4 Super: ’56 Fender Super от Huw Price @ Guitar.com

КОНФИГУРАЦИЯ БАЗЫ
Динамики Weber 10A125, трансформаторы Mercury Magnetics, конденсаторы Jupiter Yellow, резисторы из углеродного состава.

Базовая цена 1400 долларов США

ОПЦИИ

Динамики

  • 2 x Weber 10A100 (винтажные правильные) — 10 долларов США
  • 2 x Eminence Legend 1028K — 40 долларов США
  • Ваши предпочтительные динамики TBD

Конденсаторы

Blue

  • Красный Юпитер + 60 долл. Гитара.com

    Постоянные читатели будут знакомы с представленным здесь Fender Super 1956 года, поскольку его восстановление было задокументировано в мастерской DIY в мартовском выпуске G&B. Это одна из переходных моделей 5E4-A Fender с двигателями 6V6, а не 6L6, а не модель, которую вы видите каждый день.

    V Front Super (справа), предоставленный нам бутиком Vintage Guitar, старше и еще реже, по причинам, которые мы обсудим позже. Это не будет «перестрелкой» усилителей как таковой, а скорее упражнением по «сравнению и контрасту», чтобы получить представление о том, как менялись дизайн и звучание усилителей Fender Super на протяжении 1950-х годов.

    1950 5B4 Крыло Super

    V-образный передний со снятой задней крышкой. В нем пара силовых клапанов JJ 6L6, и все конденсаторы заменены на современные эквиваленты

    Этот усилитель был одним из первых комбо Fender и, возможно, самым исторически значимым. Выпущенный в конце 1946 года под названием Dual Professional, жемчужный свет, монтажная плата с проушинами, закрытый корпус с пальцами, переключатель включения / выключения и два динамика были первыми для усилителей Fender.

    К концу 1947 года название было изменено на Super, а покрытие было изменено на твид. Нововведения в этом усилителе задают базовый шаблон для всех усилителей Fender, выпускаемых на протяжении 1950-х годов и позже. Визуально кабинет кажется более близким к более поздним твидовым твидам с широкими и узкими панелями, чем к его современникам с телевизионными фасадами.

    Отличительная черта Super — наклонная передняя часть с хромированной металлической центральной полосой — достаточно легко понять, почему эти модели стали известны как V Fronts.Fender передала шкафы на аутсорсинг, и они были более сложными, чем те, которые компания впоследствии построила собственными силами.

    На этих ранних усилителях компания Fender смонтировала выходной трансформатор на шасси динамика. Не все выжили, но у этого

    Фронты

    V довольно редки — отчасти потому, что Fender не производил их много, а отчасти потому, что Билли Гиббонс, кажется, скупает все хорошие! Он, как известно, использовал V Front при записи Antenna.Модель V Front Super выпускалась с 47 по 52 год, и с этой конструкцией связаны три обозначения модели: 5A4, 5B4 и 5C4. В 5A4 были лампы предусилителя 6SJ7 и три входа, а не четыре, и Fender начал использовать лампы 12AY7 в 5C4.

    Коды динамиков Jensen P10R в этом корпусе читаются как 220951, что означает, что они могут быть датированы 1949 или 1959 годом. Крошечный шрифт, используемый для кода производителя / даты, и этикетки в раннем стиле, похоже, указывают на первое. На 5E4-A также установлено два Jensen P10R, и все четыре были переконфигурированы.

    Таблица ламп в отличном состоянии и предполагает, что это может быть один из первых 500 ампер Fender, когда-либо выпущенных

    Судя по лампам 6SC7, четырем входам, серийному номеру и кодам динамиков, наиболее вероятно, что это 5B4, который был изготовлен в 1950 году. Коды горшков показывают 11-ю неделю 1950 года, что, вероятно, сужает окно до где-то между концом марта и серединой того же года.

    V Front претерпел некоторые электрические реставрационные работы, потому что это был рабочий усилитель для его нынешнего владельца.Если оригинальность является вашей главной заботой, вы должны знать, что был установлен заземленный сетевой кабель вместе с тремя конденсаторами фильтра Sprague Atom в блоке питания — разумные модификации, которые обеспечат вам безопасность и надежность усилителя, и наоборот.

    Всегда приятно найти оригинальную наклейку из липкой ленты с подписью человека, который собирал усилитель. Этот был сделан Лили

    Фактически заменены все электролитические элементы, а также конденсаторы в тракте прохождения сигнала.Пленочные колпачки ERO / Vishay используются в каскаде предусилителя, а во всем остальном — Sprague Orange Drops. Хотя работа выполнена надлежащим образом, я бы не стал называть ее эстетически привлекательной реставрацией. Тем не менее, это качественные современные компоненты, которые хорошо звучат, и на них можно положиться, чтобы усилить работоспособность в течение многих лет. Все мощные композитные резисторы из углеродного волокна выглядят оригинальными, а оригинальный катодный резистор смещения 250R все еще находится на месте.

    6SC7 — это старые Tung-Sols американского производства, они объединены с парой современных JJ 6L6 и выпрямителем Winged C 5U4G.У крыльев этой эпохи выходные трансформаторы были установлены непосредственно на шасси динамика, и этот, кажется, был оригинальным с кодом, который выглядит как 1848.

    У ранних усилителей были эти металлические пластины с буквенным логотипом Fender.

    Однако силовой трансформатор был заменен, поэтому я решил сравнить напряжения в этом усилителе с показаниями, взятыми из оригинального примера. Все пластины клапана предусилителя были примерно на 10 вольт выше указанных 70, но это хорошо в пределах плюс-минус 20-процентного запаса Fender.

    Катодно смещенные 6L6 получали на пластинах 420 вольт, что немного выше, чем у других усилителей, но более или менее соответствовало напряжениям на пластинах, которые Fender использовал в 5F4 Super к концу 50-х годов. Ранние твидовые схемы Fender были опубликованы без спецификаций напряжения, поэтому технические специалисты могут настроить эти усилители на слух и убедиться, что клапаны работают в пределах рекомендуемых параметров.

    Металлическая центральная полоса прикручена к шасси болтами, а перегородки динамиков — к металлической полосе

    Корпус по-прежнему выполнен из оригинального низкоконтрастного твида и находится в очень хорошем косметическом состоянии, учитывая его возраст.Даже коричневая льняная ткань динамика остается безупречной и безупречной. Ручка почти наверняка заменена, но вам должен понравиться маленький именной значок с квадратным ранним логотипом Fender. Логотип спагетти рано появляется на панели управления с трафаретной печатью.

    1956 5E4-A Крыло Super

    Смещение динамиков позволило Fender сделать более поздний кабинет Super немного уже

    Недавно представив этот усилитель в G&B, я не буду вдаваться в подробности его описания.Достаточно сказать, что он датируется августом 1956 года, и в нем до сих пор сохранились оригинальные динамики, дроссели и трансформаторы. Он был перекрашен в твид и, как и V Front, подвергся тщательной электронной реставрации.

    Клапанный ряд из двух 12AX7 и пары 6V6 очень необычен для твидовых Supers и делает его довольно редким усилителем

    Стоит отметить, насколько сильно изменилось за шесть лет между этими усилителями; Блок питания был усилен воздушной заслонкой и переключателем режима ожидания, а с завода он вышел с переключателем заземления.В каскаде предусилителя есть «современные миниатюрные» клапаны, с 12AY7 спереди и двумя 12AX7. Для силовых клапанов 6V6 используется фиксированное смещение.

    Коды даты динамика соответствуют дате производства 1956 года

    Простая регулировка спада высоких частот превратилась в стек тембров в стиле Баксандала с отдельными регуляторами высоких и низких частот. Есть даже контроль присутствия, который демонстрирует, что Fender начал использовать отрицательную обратную связь.Оба усилителя рассчитаны на мощность около 22 Вт, но в течение нескольких месяцев Fender вернется к силовым клапанам 6L6 с более мощным выходным трансформатором для 35-ваттного 5F4.

    Используется

    Когда я вернул Эду его ’56 Super, я почувствовал, что это лучший твид 50-х, на котором я когда-либо играл. Я немного опасался, что V Front Super не сможет соответствовать, поэтому я рад сообщить, что это неуместная проблема. Неудивительно, что BFG их любит. Я использовал Fender Deluxe ’51 в качестве основного усилителя более десяти лет.В исходной форме у него были прекрасные теплые средние частоты, но высокие частоты были слишком приглушены, а неэффективный Jensen казался немного дряблым и безжизненным. Установка Celestion Blue и выполнение нескольких других мелких настроек вылечили все недуги.

    Я наполовину ожидал того же от Super, но этот усилитель — совсем другой зверь. Нет недостатка в высоких частотах, и увеличение тембра не увеличивает усиление так сильно, как на Deluxe. Super намного громче и распространяет звук по комнате — проходите через переднюю часть усилителя во время игры, и вы увидите единообразие звука, а не заметную зону наилучшего восприятия.

    Что у него общего с Deluxe, так это восхитительно полные, округлые и жевательные средние частоты. Это то, что я также заметил на усилителе Elektra 185, который мы недавно представили, и поклонники твида обычно считают это звуковой характеристикой восьмеричных ламп предусилителя.

    V Front имеет конденсаторы фильтра Sprague Atom и сигнальные конденсаторы Orange Drop, но резисторы оригинальные

    Я бы согласился, но я давно отказался от 6SL7 в своих преобразователях Deluxe for Groove Tube, чтобы использовать более современные предусилители.Я бы не стал этим заниматься, но я обнаружил, что невозможно получить надежные и немикрофонные восьмеричные клапаны.

    6SC7 в этом Super немного микрофонны, поэтому вы слышите странные высокочастотные звонки, а также редкие низкочастотные волчьи тоны. К счастью, через некоторое время они уменьшаются. Фактически, улучшение тона после прогрева усилителя действительно очень заметно.

    Сравните эту старинную этикетку динамика Jensen с этикеткой конца 50-х годов на динамиках ’56

    Плюс перехода моего Deluxe на «современные» предусилители — это более чистый звук с дополнительным усилением.Если бы этот V Front был моим, я бы сохранил 6SC7, потому что нет недостатка в усилении или ясности. Это самое удивительное в этой комбинации — она ​​не похожа на усилитель, созданный в 1940-х годах. Чтобы прояснить это, это, несомненно, твид 50-х годов. Тем не менее, он громкий, резкий, яркий и полностью лишен прямоугольности, а низкие частоты остаются твердыми и без провисания даже при максимальной громкости.

    На малой громкости вам нужно увеличить тон, но вы будете вознаграждены нежнейшими высокими частотами и звучанием, которое будет ярким, но лишенным резкости.Кажется, что ничего не бросается в глаза, поэтому играть легко, но без сжатия. Кантри, джаз, рокабилли — что угодно, этот усилитель умеет.

    Удерживая высокий тон и постепенно увеличивая громкость, вы получаете великолепный гармонично загруженный овердрайв. Сыграйте низкую E или ударьте по пауэр-аккорду с помощью P-90 или звукоснимателя Tele Bridge, и этот усилитель обладает тональной сложностью фортепиано. Изобилуют агрессивные блюзовые риффы и энергичный рок-н-ролл, и эти клапаны очень хорошо реагируют на звукосниматели, которые могут дать дополнительный толчок.

    Я подумал, что сниму несколько тонов Гиббона с моим Lester, и наткнулся на волшебную настройку с полной громкостью и откатом тона примерно до трети. V Front представил самые отвратительные тона блюз-рока. Просто шлифовать низкие струны или щелкать по грифу и соло наверху — сплошное удовольствие. Это в целом более землистый и первобытный тон, чем звучание бино и классического блюз-рока.

    Итак, перейдем к 5E4-A. Опять же, этот усилитель звучит так, как будто он намного опередил свое время.Динамический отклик и базовый характер овердрайва очень мягкие, но заостренные средние частоты в сочетании с значительно расширенным диапазоном высоких и низких частот обеспечивают очевидную дорожную карту для усилителей Brownface, Blackface и Marshall, которые появятся на сцене несколько лет спустя. .

    На некотором расстоянии он громче из двух, но это означает, что здесь намного больше чистого пространства над головой. С Tele вы можете выбрать курицу и услышать звучание Бейкерсфилда. У Strats есть то стеклянное мерцание Hendrix и SRV в их более мягкие моменты, и вы можете набрать древесные, но отчетливые джазовые тона с хамбакерами и P-90.

    Повышение уровня высоких частот значительно увеличивает усиление. Фактически, высокие частоты должны быть достаточно высокими, чтобы получить перегрузку 5E4-A, поэтому присутствие практически не усиливается. Овердрайв также звучит иначе, потому что он тяжелее, дикой и свирепей, чем все, что может произвести V Front.

    С помощью Tele вы можете укусить Спрингстина в Darkness On The Edge Of Town. Подключите Les Paul, и он будет насыщенным блюзом и тяжелым роком, но без утомительной пронзительности некоторых более поздних усилителей.Высокие частоты легко переплетаются с верхом, а басы звучат обширно.

    Как бы я ни обожал V Front, я должен признать, что 5E4-A — более универсальный и практичный концертный усилитель. V Front имеет очень характерный тон, который был бы замечателен в правильном ретро-контексте, но вам будет трудно получить все тона, которые могут понадобиться для игры в кавер-группе. С 5E4-A нет таких проблем, потому что вы можете покрыть каждую базу этим.

    Общие звуковые атрибуты включают красиво сочетающиеся и легкие динамические характеристики, сверхъестественную способность переходить от великолепного овердрайва к искрящемуся чистому с помощью простой настройки регулятора громкости, мерцающие и постоянно меняющиеся верхние гармоники и безошибочную способность удерживать ноты цветут.

    Этого достаточно, чтобы заставить вас задуматься, зачем нам когда-либо понадобились педали компрессора, овердрайва и хоруса — хотя оба усилителя также хорошо работают в качестве педальных платформ.

    В целом, я подозреваю, что это сравнение раскрыло больше о том, как эволюционировали твидовые Supers, а не твиды Fender 50-х годов в целом. V Front Super — это удивительный монстр, который не обязательно отражает ранний твидовый оттенок. Фактически, с высокими напряжениями HT, работающими в усилителе мощности, он может вообще не соответствовать звучанию
    V Front.

    В конце концов, я не мог выбрать между этими твидовыми Supers. Как только я начинал отдавать предпочтение одному, я подключался к другому и передумал. Думаю, решение простое — мне нужно выиграть в лотерею и купить и то, и другое вместе с коробкой ПБЯ.

    Основные характеристики
    1950 5B4 Fender V Front Super
    • Цена 3 850 фунтов стерлингов
    • Описание Двухканальный комбинированный клапан с ручной проводкой, производство США
    • Номинальная мощность 20 Вт
    • Клапаны 3x 6SC7, 2x 6L6, 1x 5U4G
    • Панель управления 4 входных разъема, громкость, громкость, тон
    • Динамик 2x Jensen P10R
    • Размеры 19.5 (в) x9,75 / 8,75 (г) x22,5 (ш) дюймов
    • Вес 15,6 кг
    • Свяжитесь с бутик-магазином Vintage Guitar
    0207 729 9186
    www.vintageguitarboutique.com
    1956 5E4-A Fender Super
    • Цена N / A
    • Описание Двухканальный комбинированный клапан с ручной проводкой, производство США
    • Номинальная мощность 22 Вт
    • Клапаны 1x 12AY7, 2x 12AX7, 2x 6L6, 1x 5U4G
    • Панель управления 4 входных разъема, громкость, громкость , высокие частоты, низкие частоты, присутствие
    • 2 разъема для динамиков на задней панели
    • 2 динамика Jensen P10R
    • Размеры 18 (в) x9.24 дюйма x 22 дюйма
    • Вес 15 кг


    антитело против Pit1 [5E4] (ab10545) | Abcam

    Обзор

    • Название продукта

    • Описание

      Мышь моноклональная [5E4] для Pit1

    • Вид-хозяин

      Мышь

    • Протестированные приложения

    • Реактивность видов

      Реагирует с: Rat
      Предназначен для работы с: Овца, Корова, Человек, Свинья, Обезьяна-макака
    • Иммуноген

      Рекомбинантный фрагмент:

      SAAECLPASN HATNVMSTAT GLHYSVPSCH YGNQPSTYGV MAGSLTPCLY KFPDHTLSHG FPPLHQPLLA EDPAASEFKQ ELRRKSKLVEE PIDMDSPEIR ELERIKL 9000, соответствующий аминокислотам PIDMDSPEIR ELEQFANEFK крысы 30-100.

    • Общие примечания

      Отрасль наук о жизни уже несколько лет находится в тисках кризиса воспроизводимости. Abcam лидирует в решении этой проблемы, предлагая ассортимент рекомбинантных моноклональных антител и клеточных линий, отредактированных с помощью нокаута, для проверки на соответствие золотому стандарту. Перед покупкой убедитесь, что этот продукт соответствует вашим потребностям.

      Если у вас есть какие-либо вопросы, особые требования или проблемы, отправьте нам запрос и / или свяжитесь с нашей службой поддержки перед покупкой.Ниже приведены рекомендуемые альтернативы для этого продукта, а также публикации, отзывы клиентов и вопросы и ответы

      .

    Недвижимость

    • Форма

      Жидкость

    • Инструкции по хранению

      Поставляется при 4 ° C. При доставке аликвотируйте и храните при -20 ° C или -80 ° C. Избегайте повторяющихся циклов замораживания / оттаивания.

    • Буфер памяти

      Среда для культивирования тканей: 15% FBS, DMEN 4.5 г / литр глюкозы и 10% NCTC 109.
      Добавки: бычий инсулин, щавелевоуксусная кислота, глицин, L-глутамин и пен-стреп.

    • Загрузка информации о концентрации …
    • Чистота

      Надосадочная жидкость тканевой культуры

    • Клональность

      Моноклональный

    • Клонирующий номер

      5E4

    • Миелома

      NS1

    • Изотип

      IgG2a

    • Тип легкой цепи

      каппа

    • Направления исследований

    Сопутствующие товары

    • Совместимые вторичные компоненты

    • Изотипический контроль

    Приложения

    Гарантия Abpromise

    Наша гарантия Abpromise распространяется на использование ab10545 в следующих протестированных приложениях.

    Примечания по применению включают рекомендуемые начальные разведения; Оптимальные разведения / концентрации должны определяться конечным пользователем.

    Приложение Отзывы Банкноты
    WB

    1/40. Обнаруживает полосу приблизительно 31 кДа (расчетная молекулярная масса: 33 кДа).

    ICC / IF

    Использование при концентрации, зависящей от анализа.

    IP

    Использование при концентрации, зависящей от анализа.

    Примечания

    WB
    1/40.Обнаруживает полосу приблизительно 31 кДа (расчетная молекулярная масса: 33 кДа).

    ICC / IF
    Использование при концентрации, зависящей от анализа.

    IP
    Использование при концентрации, зависящей от анализа.

    Цель

    • Функция

      Фактор транскрипции, участвующий в спецификации лактотропных, соматотропных и тиреотропных фенотипов в развивающейся передней доле гипофиза.Активирует гены гормона роста и пролактина. Конкретно связывается с консенсусной последовательностью 5′-TAAAT-3 ‘.

    • Поражение болезнью

      Дефекты в POU1F1 являются причиной дефицита гормона гипофиза комбинированного типа 1 (CPHD1) [MIM: 613038]. CPHD характеризуется нарушением выработки гормона роста (GH) и одного или нескольких из пяти других гормонов передней доли гипофиза.

    • Сходства последовательностей

      Принадлежит к семейству факторов транскрипции POU.Подсемейство класса 1.
      Содержит 1 гомеобоксный ДНК-связывающий домен.
      Содержит 1 домен, специфичный для ПО.

    • Сотовая локализация

      Ядро.

    • Информация от UniProt
    • Ссылки на базу данных

    • Альтернативные названия

      • Карликовые антитела
      • Антитело к GHF 1
      • Антитело GHF 1A
      • Антитело GHF-1
      • Антитело GHF1
      • Антитело GHF1A
      • Антитело к фактору 1 гормона роста
      • Антитело к Hmp 1
      • Антитело Hmp1
      • Антитело к Pit 1
      • Pit 1 бета-антитело
      • Антитело PIT 1Z
      • Антитело PiT-1
      • Антитело бета Pit1
      • PIT1_HUMAN антитела
      • Антитело к PIT1Z
      • Антитела к гормону роста гипофиза
      • Гипофизарно-специфические антитела к положительному фактору транскрипции 1
      • Гипофизарно-специфические антитела к положительному фактору транскрипции 1
      • POU, гомеобокс 1, класс 1, антитело
      • Домен POU, антитело к фактору транскрипции 1 класса 1
      • Антитело к регулятору транскрипции домена POU
      • Антитело POU1F1

      посмотреть все

    Изображения

    • Вестерн-блот — антитело против Pit1 [5E4] (ab10545)

      При разведении 1:40 вестерн был очень хорош в отношении ядерного лизата Gh4, который имеет обильную экспрессию Pit1.

      При разведении 1:40 вестерн был очень хорош в отношении ядерного лизата Gh4, который имеет обильную экспрессию Pit1.
    • Иммуноцитохимия / иммунофлуоресценция — антитело против Pit1 [5E4] (ab10545) Это изображение любезно предоставлено Зелтоном Дейвом Шарпом

      IF с использованием ab10545, выполненного в соответствии со справкой (см. Ниже) Зелтоном Дэйвом Шарпом из Техасского университета в Сан-Антонио.

    • Иммунопреципитация — антитело против Pit1 [5E4] (ab10545)

      Антитело к Pit1 (ab10545) обнаруживает полосу 33 кДа в IP, за которой следует WB.

    Список литературы (3)

    ab10545 упоминается в 3 публикациях.

    • Huang Y et al. IRF1-опосредованное подавление PGC1a способствует развитию кардиоренального синдрома 4 типа. Nat Commun 11: 4664 (2020). PubMed: 32938919
    • Choi SY et al. Ингибитор дипептидилпептидазы-4 гемиглиптин защищает от кальцификации сосудов при экспериментальном хроническом заболевании почек и гладкомышечных клеток сосудов. PLoS One 12: e0180393 (2017). WB ; Человек . PubMed: 28686724
    • Mancini MG et al. Субъядерное разделение и функциональная регуляция фактора транскрипции Pit-1. J. Cell Biochem. 72: 322-38 (1999). PubMed: 10022514

    Отзывы клиентов, вопросы и ответы

    Просмотров: 10Просмотров: 50Просмотров: 100Сортировать по: Наивысшим голосам Сортировать по: Наименьшим голосам Сортировать по: Новейшим Первым Сортировать: Старым Первым

    Образец

    Лизат клеток мыши — ядерный (линия тиротропных клеток (Т-альфа-Т-1))

    Отрицательный контроль

    Пустая область (называемая Ct2, вперед: TGCATAAATCAAATGCCCATA, обратная: GCAAAGGTGATTTGCAGAAA), промоторная область бета-актина (вперед: CTTCCTTTGTCCCCTGAGCTT, обратная: TCCATGGCGAACTATCAAGAC).

    Спецификация

    Тиротропная клеточная линия (Т-альфа-Т-1)

    Шаг обнаружения

    ПЦР в реальном времени

    Тип

    Сшивание (X-ChIP)
    Продолжительность этапа сшивания: 30 минут (с) и 0 секунд (с)
    Спецификация сшивающего агента: параформальдегид

    Положительный контроль

    Промоторная область бета субъединицы тиреотропного гормона (Tshb) (вперед: CAGAGTTTCCAGGGAGAGGA, на обороте: CGAATTGCTGCTTTCTTATCTG).PIT1, как известно, связывается с этой областью промотора Tshb в тиреотропных клетках (Yumiko Kashiwabara, et al. 2009).

    Г-н Винсент Пачини

    Проверенный клиент

    Отправлено 26 мар 2019

    160 Imlay St Apt 5E4, Brooklyn, NY 11231

    Just in — КРАСНЫЙ КРЮЧОК ЗАНЯЛ № 4 из 10 ТОП-10 СОСЕДЕЙ, которые стоит посмотреть в 2022 году! ИЗДАНИЕ WHITE BOX.Все началось с эскиза … а затем идеи, а затем еще одной идеи, пока они не сделали ее своей собственной и не сделали Red Hook своим ДОМом. Резиденция 5E4 — это квартира площадью 2858 кв. Футов в белом ящике CORNER, предлагающая ультра-просторную, универсальную планировку и исключительную возможность для покупателя создавать и строить свои собственные индивидуальные апартаменты с тремя и тремя с половиной спальнями. -ванныйна этаж сквозной дом мечты. Эта квартира с чистым холстом имеет северную, южную, восточную и западную экспозиции, этот дом демонстрирует, как шкатулка с драгоценностями, самые вдохновляющие, идеальные для открыток виды на Статую Свободы, горизонт Манхэттена и центр Бруклина, а также широкие виды на гавань.Red Hook Lofts — это коллекция из 70 изысканных студий и резиденций с четырьмя спальнями и настраиваемых домов мечты белого цвета на набережной Ред-Хук в Бруклине, предлагающих невероятное соотношение цены и качества за пространство и качество. Обширные удобства включают круглосуточное обслуживаемое лобби с лаунджем, суперинтендант на территории, современный фитнес-центр, велнес-люксы с отдельными душевыми и саунами. Открытая парковка и частная кладовая доступны за дополнительную плату. График A Расчетные ежемесячные налоги 1 842 доллара США.02. В соответствии с Законом о налоге на недвижимость в Нью-Йорке на 2021–2022 годы налоги составляют 585,17 долларов в месяц / 7 022 долларов в год. Эти исключительные дома-лофты приветствуют вас в своих светлых, гармоничных пространствах с их грандиозными пропорциями, крупногабаритной планировкой, высокими потолками от 12 до 16 футов, стальными окнами с двойным остеклением, феноменальными открытыми пространствами и культовыми ВИДАМИ. Эти современные лофты, сохранившие оригинальную архитектурную форму здания из бетона, открытые потолки и колонны, невероятно просторны и открыты. Отель Red Hook Lofts идеально расположен в одном из самых очаровательных прибрежных районов Бруклина.Red Hook, широко известный как богемная Мекка для художников, обеспечивает дружелюбную коллективную атмосферу, окруженную творчеством, позитивной атмосферой и энергией культурно разнообразного сообщества, предлагая превосходные обеды, коктейльные заведения ручной работы, домашние рынки, ультрасовременные художественные галереи, музыкальные площадки и т. Д. и широкий выбор разнообразных тусовок. Местные фавориты включают Steve’s Authentic Key Lime Pie, Defonte’s, Botanica, Sunny’s, Red Hook Lobster Pound, Hometown BBQ, Brooklyn Crab, Cacao Preto и Pioneer Works.Это не приношение. Полные условия предложения находятся в Плане предложения, доступном у Спонсора. Файл № CD13-0114 юридического департамента штата Нью-Йорк. Спонсор: Red Hook 160 LLC c / o Funaro & Co., P.C., 350 5th Avenue, 41st Floor, New York, NY 10118. Планировка квартир, площадь в квадратных футах и ​​размеры являются приблизительными. Планы, спецификации и материалы могут отличаться в зависимости от конструкции, полевых условий, требований и наличия. Спонсор оставляет за собой право вносить изменения в соответствии с планом предложения.Квартиры не будут предлагаться меблированными. Показанные макеты мебели предназначены только для ознакомления. Не дается никаких заверений или гарантий, что владелец квартиры не сможет реализовать показанную компоновку мебели. Предполагаемым покупателям рекомендуется ознакомиться с полными условиями плана предложения для получения более подробной информации о типе, качестве и количестве материалов, приборов, оборудования и приспособлений, которые будут включены в квартиры, помещения с удобствами и общую площадь кондоминиума.

  • Добавить комментарий

    Ваш адрес email не будет опубликован. Обязательные поля помечены *